SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038514 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038514
Domain Number 1 Region: 20-194
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.56e-30
Family Laminin G-like module 0.00000107
Further Details:      
 
Domain Number 2 Region: 216-393
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000343
Family Laminin G-like module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038514   Gene: ENSMODG00000025683   Transcript: ENSMODT00000040114
Sequence length 403
Comment pep:known_by_projection chromosome:BROADO5:2:254913727:254918805:-1 gene:ENSMODG00000025683 transcript:ENSMODT00000040114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLRSLTLLLLLLLWPPETWEELAPDLSLPTKISRDPAVLHLGSGLGQKPVTVMAFNLS
QVTRAISSFELRTWDPEGVIFYGDTNPKDDWFVLGLRGGRLEVQMYNLWARLTVGAGPRL
DDGHWHQLEIKNQRDSVFLEVDGDEVLRLSQVSRPLAGTALPIMRIALGGLLFPPTDLHL
PLNPALDGCLRRHIWLNQPGSAVPFSHPPQGACSLKAQPGTFFPPRAHTVFSLKDLPQPS
VDPWTFSLELRLQFFGGSGGLLSLGILGNHSLLSLDLQDQILVLSAKLPQQIEMDSKSLP
LSPGTVIQLELSLTRVAVSQGPHEVAFILPPLLLVSLLDLWTQPKGSLLLGVAPGETSSA
FFCLDGLRVQGRELDVDEALSRSKNIWSHSCPGSLNNSTNTPH
Download sequence
Identical sequences F6U048
ENSMODP00000038514 ENSMODP00000038514 XP_001369545.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]