SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039327 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039327
Domain Number 1 Region: 163-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-24
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039327   Gene: ENSMODG00000027510   Transcript: ENSMODT00000042437
Sequence length 301
Comment pep:novel chromosome:BROADO5:4:405187342:405299579:1 gene:ENSMODG00000027510 transcript:ENSMODT00000042437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGLDQPRPLPQLPPDARGGAGKALPRPQAPTDEVSPLGAATLGSTPGWPRSQRNGPRDP
EAPLPGHPILVRLADGVRAQTNETRARFCGSPTVSRSWPQRQTAAPWTSQRPKPSKAKAQ
SPLEGEEGDHRGIPRIPGLIVLSEVVDQNREREAAGGAALQVAAQGSITFQDVAVYFTQE
EWRLLDHSQKELYLEVMLENVQNLLSVGLPVPRENFISCFQQGEAPWLLEQKGPRSSCPE
SETTFEVKEMFTKLSLFVDGCDPQRCMNEGAYDFIVRKICDSNIKLSFGVLHACKRSPSR
P
Download sequence
Identical sequences K7E0M6
ENSMODP00000039327 ENSMODP00000039327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]