SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039951 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039951
Domain Number 1 Region: 45-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000988
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039951   Gene: ENSMODG00000028801   Transcript: ENSMODT00000043055
Sequence length 142
Comment pep:novel chromosome:BROADO5:3:199756527:199769857:-1 gene:ENSMODG00000028801 transcript:ENSMODT00000043055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRDFAKGDNVYILLTVDDISHLRSNKSSHIPLKMPTLQRDSGADLCENFHCENDGVCV
IYKDKAECRCRSLKDLWFVGEKCQIQMFASLQSTVEALFLVTSFAVAVVASLLSFYYGKK
KYGRRKNARTSNMTIENQNTPS
Download sequence
Identical sequences K7E2F0
ENSMODP00000039951 ENSMODP00000039951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]