SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040136 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040136
Domain Number 1 Region: 525-613
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000303
Family DEATH domain, DD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040136   Gene: ENSMODG00000027597   Transcript: ENSMODT00000043238
Sequence length 616
Comment pep:novel chromosome:BROADO5:7:258784508:258840356:1 gene:ENSMODG00000027597 transcript:ENSMODT00000043238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALALAPPPPSSFHSLLPPPFNSLLPPPFPALRGAFPPPAACGRTRRALLRRLSGYAFP
SRPPPPSLPPPGGARSPRLHSVRTHAASPPPPVAIMSSSLSSQESEGPEEDSSGYDTLSS
QDRESVSETVSSLQGTSPGTGSGEESSESSTETESESEESQLEAGKSSEEQTESSAEESS
FFQAEDPRKAEFQGPFPAELGYPLAHCEHCITENKQNEQVMPRQLSRGQFLLKVDSEGTY
QCARTGLIFEVNKKTDIKYSVLSWSKYADLVVKPWIVGGPLFDVKCDPAILVSIQFPHSL
CLGHHDSLMTFKVFHLTKSGPSLESTVDHSTTHVKWHVSSLSPVGPVIQAQEAVQHHGAV
ILYKVIDGHPSLSFRVYVATNNDSFIKDIAKSVKHSSKKFMKIDKPPVCLKLLENGKRYR
LVSEPEAEITPEEIEFVDGSLLKLKSYIEVFLEQPLEFKLSLVELDSEEIVWKAKLRECD
WIQHDQNQNVQNVSRRRKKSDSLPEEEYCVKRPKYDEAPEPTDQEKVLSDKQLMTLARKL
GKEWIQLAIANLGLEIADIDNIQEKSEDITVCKFRMLKKWQEKERNSATAKNLYNCLESD
ASIEVHEMLKGFLEKM
Download sequence
Identical sequences K7E2Y5
ENSMODP00000040136 ENSMODP00000040136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]