SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000031 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000031
Domain Number 1 Region: 476-1004
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.43e-143
Family alpha-mannosidase, C-terminal domain 0.000000000019
Further Details:      
 
Domain Number 2 Region: 53-385
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.26e-113
Family alpha-mannosidase 0.000000000211
Further Details:      
 
Domain Number 3 Region: 386-491
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.09e-29
Family alpha-mannosidase, domain 2 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000031   Gene: ENSOPRG00000000033   Transcript: ENSOPRT00000000033
Sequence length 1012
Comment pep:novel genescaffold:pika:GeneScaffold_4999:70273:84575:1 gene:ENSOPRG00000000033 transcript:ENSOPRT00000000033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGASGTMSPGAAARRGRAGACGAAGRAGRGSLHPPAWLFLLWLVAGRTRAADYETCPRVQ
PDMLNVHLVAHTHDDVGWIYTVDQYYYGGQNDLLHPGVKNILDSVFAALQAEPSRRFVYV
EMAFFSRWWHQQTNATQQAVQELVRQGRLEFANGGWVMNDEAATHYGAIVDQMTLGLHFL
QKTFGEDGRPRVAWHIDPFGHSREQASLFAQMGFDGVFLGRVDYQDREARMKRKKMELVW
RASASLKPPTADLFTGVLPNLYDPPKNLCWDTLCDERSIVDNPEDFQYNAQEVVDYFLRM
AADQHRYYRTNHIVMTMGGDFHYGYANSWFKNLDKLIQLVNAKQENGSRVHVLYSTPACY
LRELNKANLTWSVKEDDFFPYADGPHQFWTGYFSSRPALKHYERVSYNFLQVCKQLEALT
GWEANKGPYGWGTSTVLEEAMAVLQHHDAISGTARQNVADDYAHKLATGWRPCQVLMSNA
LAWLSGSIEDYSTCPGLNISFCVLSQISAQFQVTIYNPLGRKVAHMVRLPVNEGTFLVKD
PKGNAVTSDVVMNPQAETQIPIPELLFPASVPALGFSVYSIARVSRQNPKFHMPKSIPRH
SNSDVLMIQNKYIRATFSAETGLLMKIENMGQKVVLPVSQSFFWYKASIGDRKLQQSSGA
YVFRPHRRQPLPVSQRAEIYLVKSSLVQEVHQNFSDWCSQVVRLYRGQRHLELQWTVGPI
PTADGWGKEVISRFDTPLDTKGHFYTDSNGREILTRRRDYRPTWSLNQTQVVAGNYYPVN
TRIFIKDGEKQLTVLTDRSQGGSSLRDGSLELMVHRKLLRDDCRGVGEALLEQGSGLVVR
GRHLVLLDAVDQAAAGHRLLAEREVLAPQVFLAPGGGAPYFQGAPRRTQFSGLLRELPPS
VHLLTLARWGPDRLLLRLEHQFALGEDSGHNLSSPVTLNLQDLFSTVTITHLQETTLAAN
QPRESASRLKWTPDTDAAPYPPAAPVDPTTITLQPMEIRTFVASVLGELDPW
Download sequence
Identical sequences ENSOPRP00000000031 ENSOPRP00000000031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]