SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000148 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000148
Domain Number 1 Region: 214-377,410-472
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-38
Family Voltage-gated potassium channels 0.0032
Further Details:      
 
Domain Number 2 Region: 477-659
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-36
Family cAMP-binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 35-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.41e-21
Family Flavin-binding PAS domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000148   Gene: ENSOPRG00000000167   Transcript: ENSOPRT00000000165
Sequence length 870
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4583:427459:624676:1 gene:ENSOPRG00000000167 transcript:ENSOPRT00000000165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATXYSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKS
CSCKFLFGIETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSPFWCLLDIVPIKNEKGDVV
LFLASFKDITDTKVKITPEEKKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXNVFVDKTAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPYNVC
FIGNDELSSTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVTTWFI
IDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTVVLTLLMSVFA
LLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSAYIAA
LYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWSLYH
TRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITMHLNK
EILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLKDSMV
LAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHKFVED
IQHDLTYNLREGHESDVITRLSNKSTVQQSEPQGNGSIKKRLPSIVEDEEEEEDGEEEET
ASLSPICTKGSSSSRSKKVGSSKGYLGLSLKQLASGTVPFHSPVRVSSSNSPKTKQEADT
PNHGKRKEKNLKLQLSTLNSVGPPDLSPRIVDGIEDGNSSEESQTFDFGSERIKSEPRMS
PPTGDPEIGAAVLFIKAEETKQQINKLNRE
Download sequence
Identical sequences ENSOPRP00000000148 ENSOPRP00000000148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]