SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000253 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000253
Domain Number 1 Region: 12-350
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-101
Family ALDH-like 0.00000000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000253   Gene: ENSOPRG00000000281   Transcript: ENSOPRT00000000281
Sequence length 382
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3815:26083:28796:-1 gene:ENSOPRG00000000281 transcript:ENSOPRT00000000281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEPATNNLLTKLGSAFIRKEPYGLVLIIAPWNYPLNLTLMPLVGAIAAGNCVVLKPSEM
SKGSEKVLAEVLPQYLDQSCFAVVLGGPEETGRLLEHKFDYILFTGSPRVGKIVMTAAAK
HLTPVTLELGGKNPCYVDDNCDPQTVANRVTWFRYFNTGQTCVAPDYVLCTPETRERLLP
ALQSAITRFYGEDPRSSPDLGRIINQKHFQRLQALLRCGRVAIGGQSDESQRYIAPTVLV
DVQEVEPVMQEEIFGPILXTVGGLDEAIAFINCREKPLALYAFSNNNQVVKQLLERTSSG
SFGGNEGFIYLTLSSLPLGGVGHSGMGKYHGKFSFETFSHHRACMLAPPGLEKLNEPRYP
PYSERTQQLISWALSFPTCTLL
Download sequence
Identical sequences ENSOPRP00000000253 ENSOPRP00000000253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]