SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000334 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000334
Domain Number 1 Region: 33-557
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 2.49e-160
Family Aconitase iron-sulfur domain 0.00000000000000326
Further Details:      
 
Domain Number 2 Region: 564-783
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 7.65e-65
Family LeuD-like 0.00000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000334   Gene: ENSOPRG00000000365   Transcript: ENSOPRT00000000370
Sequence length 787
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_750:16309:46986:1 gene:ENSOPRG00000000365 transcript:ENSOPRT00000000370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIRYDLLEKNISIVRKRLN
RPLTLSEKIEYGHLDDPAGQEIERRKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAV
PSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGVCIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGEERGWSGMATICNMGAEIGAT
TSVFPYNHRMKKYLSKTGRADIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHINGAF
TPDPAHPVAEVGAVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSL
FTITPGSEQIRATIERDGYAQVLRDVGGVVLANACGPCIGQWDRKDIKKGEKNTIVTSYN
RNFTGRNDANAETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELP
RAEFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGQDLEDLQILIKVKGKCT
TDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKH
GIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPA
DYNKIHPVDKLTIQGLKDFAPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALN
RMKELQQ
Download sequence
Identical sequences ENSOPRP00000000334 ENSOPRP00000000334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]