SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000361 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000000361
Domain Number - Region: 359-603
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00698
Family Quinoprotein alcohol dehydrogenase-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000361   Gene: ENSOPRG00000000397   Transcript: ENSOPRT00000000397
Sequence length 614
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4687:8933:27204:1 gene:ENSOPRG00000000397 transcript:ENSOPRT00000000397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFGDVDQVRMTTEGSDCRCKCIMRPLSKDACSRVRSGRARVEDFYTVETLSSGSDCRCSC
TAPPSSLNPCENEWKMEKLKRQAPELLKLQSMVDLLEGALYSMDLMKVHAYVRKVASQMN
TLEESIKANLSRENEVVKESMRHLSEQLKRQENHSAIMLSIQKELSSLGLQLLQKDAAPE
APALAPGGKLQGADEGKGKENSRYSSAQKSFADRGLPKPSKEKLLKAERLRESSKGRFPQ
PTGKPRALAQQQAVIRGFTYYKAGRQETTETAADNALKGTSWLAVSPKTEGQSPEPNSAA
EQDEAEPQPSEGAGLAPGMPSADPSTPTTTLAPSSTTLPTEPPAHSEAPSRGKEASCEGT
LRAVDPPVRHHSYGRHEGAWMKDPTAQDDRIYVTNYYYGNSLVEFRNLDNFKQGRWSNMY
KLPYSWIGTGHVVYQGAFYYNRAFTKNIIKYDLRQRFVASWALLPDALYEGTTPWKWRGH
SDIDFAVDESGLWVIYPAVDDRDEAQPEVIVLSRLDPGDLSVHRETTWKTRLRRNSYGNC
FLVCGILYAVDTYNQHEGQVAYAFDTHTGTDARPQLPFRNEHAYTTQIDYNPKERLLYAW
DNGHQLTYALHFVV
Download sequence
Identical sequences ENSOPRP00000000361 ENSOPRP00000000361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]