SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000487 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000487
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily Heme oxygenase-like 3.86e-73
Family Eukaryotic type heme oxygenase 0.000000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000487   Gene: ENSOPRG00000000546   Transcript: ENSOPRT00000000535
Sequence length 315
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3386:406857:411253:1 gene:ENSOPRG00000000546 transcript:ENSOPRT00000000535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEMETSEGVDESEGKNSGALEKENHIRMADLSELLKEGTKEAHDQAENTQFVKDFLKG
NIQKEIFKLATTALYFTYSALEEEMDRNKDHPAFTPLYFPMELHRKEALTKDMKYFFGEN
WEEQVQCSKGTQQYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGVQFYLFENVDNAQQFKQFYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
RSALTRETAEDGIPVHDGKGDVRKCPYYAEQVKGALGGSSCPFGAAMALLRKPSFQVILA
AGVALAAGLLAWYYM
Download sequence
Identical sequences XP_004586768.1.84141 ENSOPRP00000000487 ENSOPRP00000000487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]