SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000765 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000765
Domain Number 1 Region: 159-194
Classification Level Classification E-value
Superfamily LEM domain 0.000000000706
Family LEM domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000765   Gene: ENSOPRG00000000828   Transcript: ENSOPRT00000000834
Sequence length 416
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3316:871:4577:1 gene:ENSOPRG00000000828 transcript:ENSOPRT00000000834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
CCSDTSFVTAVESLDPEDSAGCLCTGSLPCRVQRTPGPARDAGLDTRLRALSVTSPAASR
PASPLRTPGAPCPVDDSTDKDPAILWGTEDKASLPGGRDPASDLELLRRLRALGENPGPI
TPFTRRHYLRRLQLAEAVSAGCDFTGRSPELAEALRTGRIPDARVDEDTLIREFARPDPG
RRWREGVAKSSFTYLLLDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
IETLTNQKQGHCYGVVASWPPARRRRLGVHLLYRALLVFLAEGERELRPQDIQARG
Download sequence
Identical sequences ENSOPRP00000000765 ENSOPRP00000000765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]