SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000795 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000795
Domain Number 1 Region: 156-240
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 4.71e-19
Family Translation initiation factor IF3, C-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 78-132
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.0000000106
Family Translation initiation factor IF3, N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000795   Gene: ENSOPRG00000000866   Transcript: ENSOPRT00000000867
Sequence length 277
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1617:82836:87965:-1 gene:ENSOPRG00000000866 transcript:ENSOPRT00000000867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLKQLMLQTVKTENHCIRRCFGQPLVQKVGPTTLCLLASAPRASYLIHARAFGTAED
THEERKKTKRNETDFSIVERKIKERIIQVLDEEGNDLGNMHRADVIRLMDERELRLVKGD
AQAEPPRYQLMTGLQIPQEPLRLREMEKARPKAGPILTKELTFSSNIGQHDLDTKSKQIQ
QWIEKKYHVQITVKKGRNADEPDNKTEEIFNQILQTMPGIATFKSKPQTIKGGKAVMCVL
RHLSKKEENAHRESQGSQRRDILNKEGSNRDSGDPHP
Download sequence
Identical sequences ENSOPRP00000000795 ENSOPRP00000000795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]