SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000955 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000955
Domain Number 1 Region: 10-135
Classification Level Classification E-value
Superfamily DNA clamp 0.00000000000000485
Family DNA polymerase processivity factor 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000955   Gene: ENSOPRG00000001035   Transcript: ENSOPRT00000001039
Sequence length 414
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1661:260186:280946:1 gene:ENSOPRG00000001035 transcript:ENSOPRT00000001039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCGMSGSAVKVFGKAIQALSRISDFLWLDPSEKGLALRTLNSSESSYGSILFSPVFFQ
HYQWLAPVKMKDSGTTSRLNCKLGMKSILPIFRYLNSLERNVEKCNIFTSSDNCKVVIRF
FYRHGVKRTHNLRFQESMPMQVIFEKSTCSNILMIQPRLLAEAIVLFTSSQEEVTLAVTP
LDFCLKSPHEESVDLTNSVYSEMFVGPDEFDFFQIGVNTEITFCMKELKGMLMFSEATRA
PISILFDFPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSELIQNEA
SKDSTSQVPDRLSRRATGRSTRTGTSRPQDPGSPGLEVGSTDISEVPESVVSDPEEGPGH
PHLRKFSCMFFGALAPDQQEHSHPLDHVATASDSEEDAGNTYNAPDTDEAGSLR
Download sequence
Identical sequences ENSOPRP00000000955 ENSOPRP00000000955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]