SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000990 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000990
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00000000968
Family Cgl1923-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000990   Gene: ENSOPRG00000001081   Transcript: ENSOPRT00000001076
Sequence length 263
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_181:750:16650:1 gene:ENSOPRG00000001081 transcript:ENSOPRT00000001076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFMPCGDADPDLSGFTLLMPAVSVGNVGQLATDLIISTLKMCKIGYFYTDCLVPMVGNNP
YATAEENAAELSTNAEVYSLPSKKLVVLQLRSIFIKYKSKSFCEKLLGWVERSGCARVIV
LSSSHSYQRNDKQLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPRIPEIEDSDLCVR
VPGGITKLLYDESCSRDIQMAVLLKFVSEGDNIPDALGLVEYLNEWLQIIKPRGDDPTAS
PLPWKIPSSWRLLFGSGLPPALF
Download sequence
Identical sequences ENSOPRP00000000990 ENSOPRP00000000990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]