SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001072 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001072
Domain Number 1 Region: 25-487
Classification Level Classification E-value
Superfamily ALDH-like 1.17e-91
Family ALDH-like 0.00000404
Further Details:      
 
Domain Number 2 Region: 508-770
Classification Level Classification E-value
Superfamily ALDH-like 1.31e-42
Family ALDH-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001072   Gene: ENSOPRG00000001154   Transcript: ENSOPRT00000001161
Sequence length 801
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_945:27936:38806:1 gene:ENSOPRG00000001154 transcript:ENSOPRT00000001161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRVDSRAWEIFTTMEYGPAPESHACALAWLDTQERRLGHYVNGKWLKPEHRSAVPCQ
DPVTGENLASCLQAQAEDVSAAVEAARTSLESWSRIPGAKRAQHLTRMAKMLQKHERLLW
TLESLVTGRAVREIRDGDVPLAQQLLQYHAVQAYTQEEALAGWEPMGVIGLILPRTFSFL
EMMWRICPALAMGCTVVALVPPACPTALLLAQMAGELGSFPGILNVLSGPASLGPVLAAQ
PGVQKVAFCGTVEEGRALRRTLAGQGVELGLALGTESLLLLLDSGDVDSAVEGVVDAVWS
DRSQGGLRFLIQESIWNESLKRLQARMGRLRGGRGLDSAVDMGARGAAARELAQRYVGEA
QSQGAQVFQAGDVPSDSPFYPPTLVWGLPPAAPCIQAEVPWPLVVASPFRTAKEALALAN
ATPRGGSGSVWSERLGQALELGHGLHLGTVWINSHGLRDPGVPTGGCKESGSSRHGGLDG
LYEYLRPLGTPARLPALSENPNYDTFGLAVPPTLPAGPETGPSPAPPYGLFVGGRFQAPG
SRSSRAIQDSQGKLHGYVAEGGAKDIRSAVEAAHQAAPGWTGRSPGVRAALLWSLAAAVE
RRGPSLTTRLERQGVEPKAAKAEVELSVQRLRTWGARAQVQGDTMQVPVLRGPVLRLREP
HGVLAVVCPDEWPLLAFVSLLAPALAHGNAVVLVPSMACPLLALELCQEMASLLPAGLVN
VVTGDQDHLTRCLALHQDVQALWYFGSAQGSRFVEWASAGNLKPVWVNRGSPRAWDQEAQ
GAGPELGLRAARTKALWLPMG
Download sequence
Identical sequences ENSOPRP00000001072 ENSOPRP00000001072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]