SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001082 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001082
Domain Number 1 Region: 669-856
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-46
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 523-575,605-705
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-31
Family Voltage-gated potassium channels 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001082
Domain Number - Region: 37-130
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000331
Family Flavin-binding PAS domain 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001082   Gene: ENSOPRG00000001162   Transcript: ENSOPRT00000001173
Sequence length 1105
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1357:30706:338136:-1 gene:ENSOPRG00000001162 transcript:ENSOPRT00000001173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYTEGVCELVGFSLPYVIK
PCCDFLHAPETKRHDIAQIAHFLLGSEERKVEPTYYHKSGFVQIXXXXXXXXKNQEGVAM
MFIINFEYVTDEESVASPERVNPILPVKSVNRKLFGFKFPGLRVLTYRKQSLPQEDPDVV
VIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSPKRQ
WDRLYPDMLQSSSQLTHSRSKESLCSIRRASSVHDIEGFSVHPKNIFRDRHASEXXXXXX
XXPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSDVKTEKKNTSPPSSDKTIIAPKV
KERTHNVTEKVTQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTTLIGLLKTARLLRLVRVARKLDR
YSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYNDSD
SSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVLKGF
PECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLTALY
FLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQREDLLE
VLDMYPEFSDHFLTNLELTFNLRHESAKADLLLRSQSMNDSEGDNCKLRRRKLSFESEGD
RESTNDPEDSEDTIRHYQSSKKHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGVGKAT
GLNFEETMPTSGRIPVDRRSHSCKDITELRSWDRENPRTQAEEASPSALQRAAWGISETE
SDLTYGEVEQRLDLLQEQLNRLESQMTADIQTILQLLQKQTTVVPPAYSMVTAGAEYQRP
VLRLMRTSHPMASIKTDRSFSPSSQ
Download sequence
Identical sequences ENSOPRP00000001082 ENSOPRP00000001082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]