SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001095 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001095
Domain Number 1 Region: 296-399
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.59e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00066
Further Details:      
 
Domain Number 2 Region: 60-126
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000089
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001095
Domain Number - Region: 141-169
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00374
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001095   Gene: ENSOPRG00000001179   Transcript: ENSOPRT00000001187
Sequence length 871
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3981:41278:215201:1 gene:ENSOPRG00000001179 transcript:ENSOPRT00000001187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSSPGKSSPRPLASAPSGGGRRVSPSLSAPGPAAPSRPALXXXXXXXXXXXXXXXXXXXA
SRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHNEVSAQTEICDIQ
QDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNDLEFYCHLLRGSLNPKEFPTYEYIKFVG
NFRSYNNVPSPSCNGFDTTLSRPCRVPLGKEVYFIATVRLATPQFLKEMCIVDEPLEEFT
SRHSLEWKFLFLDHRAPPIIGYLPFEVLSTSGYDYYHIDDLELLARCHQHLMQFGKGKSC
CYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVERRQELALEDPPEA
MHPSTLKDKGSSLEPQQPFSTLDTGTSGLHTSPSPSASSRSSHKSSHTAMSEPNSTPTKL
MAEANTTALPRSATLPRELPGPGASQATTMPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMFLQQPAGSL
SFSSPQRPETQQQLQQRTSGSQPQLVVSPQLPGQMTSAPVSSQHLLRESSVISTQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
LLSQPIQPMMPGSCEARQSAEIGRTGRQVKYAQNQPLFPSTDVHPASSSSSTPILLMSQA
VLHPSFPASQPSALQSAQAQQQPQQHYLQMQAPASLHSEQQDSFILSTYSQQPGTLSYSP
LPPPPVQPQPQRPPRRLSSLSESAGLQQPPR
Download sequence
Identical sequences ENSOPRP00000001095 ENSOPRP00000001095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]