SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001166 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001166
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.54e-34
Family VPS28 N-terminal domain 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001166
Domain Number - Region: 112-133
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 0.00615
Family VPS28 C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001166   Gene: ENSOPRG00000001271   Transcript: ENSOPRT00000001265
Sequence length 133
Comment pep:known_by_projection scaffold:pika:scaffold_126882:5:1280:-1 gene:ENSOPRG00000001271 transcript:ENSOPRT00000001265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVTPNEYTAACSRL
LVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVV
SLFITVMVKLRLE
Download sequence
Identical sequences ENSOPRP00000001166 ENSOPRP00000001166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]