SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001198 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001198
Domain Number 1 Region: 45-516
Classification Level Classification E-value
Superfamily ALDH-like 1.14e-160
Family ALDH-like 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001198   Gene: ENSOPRG00000001299   Transcript: ENSOPRT00000001300
Sequence length 518
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1227:499419:523825:1 gene:ENSOPRG00000001299 transcript:ENSOPRT00000001300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCSWLRCCGVLRLRPRTGCRRLAASTTQLRGYAGGLADLSAELLRTDSFVGGRWLPVA
ATFPVHDPASGATLGSVADCGVPEARAAVRAAYEAFRSWRGVSAKERSSLLREWYNLMIQ
NKDDLAKVITAESGKPLKEAQGEILYSAQFLEWFSEEARRIYGDIIATPSKERRALVLKQ
PMGVAAIITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELANRAGIPPGV
YNVIPCSRSKAKEVGEALCTDPLVSKISFTGSTATGKILLRHAASSVKRVSMELGGLAPF
IVFDSADVEQAVTGALASKFRNTGQTCVCSNRFLVQRGIHDAFVNRLAEAMKKTLHVGNG
FEAATTQGPLINEKAVEKVKHVSDAVKGVTVGGKRHPLGGNFFEPTLLSSVTQDMLCSKE
ETFGPVAPVIKFDTEEEAVAIANATDVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGLI
STVECPFGGMKQSGLGREGSKYGIDEYLEVKYVCQGGL
Download sequence
Identical sequences ENSOPRP00000001198 ENSOPRP00000001198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]