SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001332 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000001332
Domain Number - Region: 524-553
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00602
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 418-484
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00968
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001332   Gene: ENSOPRG00000001394   Transcript: ENSOPRT00000001446
Sequence length 1332
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_770:129177:161292:1 gene:ENSOPRG00000001394 transcript:ENSOPRT00000001446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIPMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYYEEVLKELMPLGV
NVLKNLDSVLSENPHDVELELLREDNEQLLTQYDCEKALRSQTKKFIEFEDALEQEKKEL
RTQVEHYELQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIERS
KLQQQVGGNSQTESSLPGRSRKERPTSLSVFPLADGMVRAPRGGKFGPAGDHWHPDDLSQ
LQSSSSYQCPPDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLTENMQPLGGDFG
GGSKNSARSREKRNSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDVCPETRL
DRPGNSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLAEIPAPFVSGMGKEV
GNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKAKLESRIKELE
EELKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDKIPMAQRRRFTRVEMARVLMERNQYKE
RLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQXXXXXXXXXXXXXXXXXXXXXXXXQN
STAEDGFSQRRSHAVCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDGRL
QACGWSLPAKYKQLSPSGSQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLTGWRPS
EDGPGNGAQPTPGRDPLTCDRETDSEPRSNHTSPEKKAKELPEADAMSSRVWILTSTLTT
SKVVIVDANQPGTVVDQFTVCNAHVLCIASIPAASDSDYPPGEMFLDNDVNPEDSSTDGV
LAGITLVGCATRCNVPHSSCSSRGDTPVLDKGQGEVAAIANGKANPSQSTEEATEATEVP
EPGPSEPEAAAVRPGTLTEHVFTDPAPTQPGSENGSEPDSNVAQHEPEPSGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKTLPTSGEGARPG
GVIHVYGDSSSDKSTSSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLDSP
SESPGPAADAEGQRLKNVLVLSGGEGYIDFRIGDGEDDETEEGAGDVGQVKPMLSKAERS
HIIVWQVSYTPE
Download sequence
Identical sequences ENSOPRP00000001332 ENSOPRP00000001332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]