SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001363 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001363
Domain Number 1 Region: 17-77
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.0000379
Family Cation efflux protein transmembrane domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 94-166
Classification Level Classification E-value
Superfamily Cation efflux protein cytoplasmic domain-like 0.0000759
Family Cation efflux protein cytoplasmic domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001363   Gene: ENSOPRG00000001490   Transcript: ENSOPRT00000001479
Sequence length 261
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4901:24891:36440:-1 gene:ENSOPRG00000001490 transcript:ENSOPRT00000001479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSLNTQNEPEEVVEKEKKSEALNIRGVLLHVMGDALGSVIVVITAIIFYVRPLASDAPCN
WQCYIDPSLTVIMVIILSSPLIETVILLQMVPKESHMEELMTKLSAVPGISSVHEVHIWE
LVSGKIIATLHIKYQKDSDYQDASRKIREIFHSAGIHSVTIQFEAVDLKESLEQKDLLLC
SSPCISKGCAKKLCCPPGALPLAHINGCAEQNGGPFPEIYRSRRDGTEVAVDMALDGYPS
NHGHAPNMMQESHLYENSTHF
Download sequence
Identical sequences ENSOPRP00000001363 ENSOPRP00000001363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]