SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001386 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001386
Domain Number 1 Region: 391-420,453-557,679-794
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.25e-56
Family Phosphate binding protein-like 0.0000000789
Further Details:      
 
Domain Number 2 Region: 24-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.77e-20
Family L-arabinose binding protein-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001386   Gene: ENSOPRG00000001498   Transcript: ENSOPRT00000001504
Sequence length 1233
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4113:141334:149868:-1 gene:ENSOPRG00000001498 transcript:ENSOPRT00000001504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGTLRPALLLTSLLGAWAGLGLGQGDQAVTVAVVFGSSGFQQAQARPRLTSQNFLDLPL
EIQPLTVGVNHTNPSSLLTQICGLLGAAHVHGIVFEDNVGTEAVAQLLDFVSSQTHAPIL
SISGGSAVVLTPKEPGSAFLQLGVSLEQQLNVLFKVLEEYDWSAFAVITSLHPGHALFLE
GVRAVADASYVSWRLLDVLTLELGPGGPRARTQRLLRQLDAPVLVAYCSRDEAEVLFTEA
AQAGLVGPGHVWLVPSLALGSTDTPPAAFPVGLISVVTESWRLSLRQKVRDGVAILALGA
HSYQRQHGALPAPAGNCQGHPGPVSPAREAFYRHLLNISWEGRDFSFSPGGYLVQPTMVV
IALSRHRLWEMVGRWERGVLHMKYPVWPRYSASLQPVVDSRHLTVATLEERPFVIVETPD
PGTGGCVPNTVPCRRHSNHTFSSRDAAPYTKLCCKGFCIDILKKLAKVVKFSYDLYLVTN
GKHGKRVRGVWNGMIGEVYYRRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNG
TVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNLTRGKKPGGPSFTIG
KSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEQYIDTV
SGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKFNQRSVEDALTSLKM
GKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKDSHWKRAIDLALLQF
LGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAMGLALLVFAWEHLVY
WRLRHSVPSSSQLDFLLAFSRGIYSCFSGVQSLGSPATPPSTFAEDSGEGSVHKNLNTGR
ITSTGKRKSLKRTTHTSQNWRGGXRAPAQSACSASRPACCPRPHASGVLPEPSTRVWEAP
GTSRVPLGHRAPQPSCRPPTPRPLPPGVSRASCRSARGVQWPARTGRGVRHLGASERPLA
PAPCRYSSFPRAERSGRPFLALFPEPREPVDLPLLGPEQLARREALLRAAWAQGRRPRHA
SLPSSVAEVFARPCPLPVRCRCSACSCLNGDVACRSLAQAQSRRLQSYGEACLEGAPEGL
PGWRHRGQVCLHSHGHLPFCWGAVCPHLPPCASQGPWFPGAWGLPAHGGRTLGLSTGYRD
CGGPSEVGAGGCEKQDFPRPCVWRRISSLESEV
Download sequence
Identical sequences ENSOPRP00000001386 ENSOPRP00000001386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]