SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001391 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001391
Domain Number 1 Region: 862-1012,1044-1079
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.26e-33
Family Protein kinases, catalytic subunit 0.00034
Further Details:      
 
Domain Number 2 Region: 63-162
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000922
Family N-terminal PAS domain of Pas kinase 0.0000134
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000001391
Domain Number - Region: 274-346
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000209
Family Heme-binding PAS domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001391   Gene: ENSOPRG00000001500   Transcript: ENSOPRT00000001509
Sequence length 1094
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1383:841:19952:-1 gene:ENSOPRG00000001500 transcript:ENSOPRT00000001509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSYCLSSLAAQNICTSKLHCPLTPEYADRPGSCSSASCCSLLRGFSAGWPTALLPAPVCN
PNKAVFTVDAKTTEILVANDKACSLLGYSSHDLIGQRLTQFFLKSDSHVLEALSEEHVEA
DGRVAVVSGTVVDIVSHSGEKIAVSVWMKKVQQEHRLCCVVVLEPVERVSAWVSFQNDXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLRLQRSVGRAQDGTTF
PLSLKLRSKVPGEGLAAPEGGYSASIWVFCTISGLITLQPDGTIYGVNHSFALMLFGYGK
AELLGKNITFLIPGFYQYMDLACDSSVRLPDLAKCLELSSDGGPRETHSDPWPAWDPASK
AQGPRVDVPPADYVLPQDEPLRLRDGQASSPEAKDPLDSGGQCLPALLPRSPTVPGGSPP
PPCDESSPKDLQTPAVGREAEAGVEGPKETLLGESGPDPADINPLTSCDSSETMLAAEQW
SGDVQACGPRQKALVNVPGEHHAAGQPAGGTIPTHHCSFLSEWALRQPSPSGMASVSPGT
PVQDELWLGLQNDREELQTSLIKERLSHLEHPTFPLPLSHCRLGGWDAHSRADSSSARYT
LATDLPGVLDQVHSSSWDLREGFFGAQMDRTSLACSCAASEPLASPCPSAVGSDLGVGGL
QVQDVLEDRELLLLSGTCFRLGEGRQFRDRCRPEPSGVSAVSPEPCKANDSESASSLLPA
SIARPEDAHRAAETPSLSAQVTSTPVTPGAACLGRQIQEGTYSGSCYHRDGMQLSIQFQV
KRVELQGSATLFCCWLVKDLLHSRQDSATRTRLLLASSHSSTHSVPELLGSSRGEVLRSK
PWFEDSPRSVSLEGLAACEGEYAHKYSTLSPLGSGAFGFVWTAVSREHNKEVVVKFIKKE
KVLEDCWVEDPKLGRVTLEIAILSRVEHANIIKVLDVFENQGFFQLVMEKHGSGLDLFAF
IDHHPSLDEPLASYIFRQVSVGKLVSAVGYLRSQSVIHRDIKDENIVIAEDXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRGPELEMWSLGVTLYTLIFEENPFCEVEE
TMEAAINPPYLVSQ
Download sequence
Identical sequences ENSOPRP00000001391 ENSOPRP00000001391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]