SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001576 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001576
Domain Number 1 Region: 2-51
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000432
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001576   Gene: ENSOPRG00000001708   Transcript: ENSOPRT00000001706
Sequence length 275
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2197:44858:56206:1 gene:ENSOPRG00000001708 transcript:ENSOPRT00000001706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIEKRRRDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPSTVSVAPCAPPLSTSLLSVSATVNAAAVTAKANGYRFEARRMLSPNEETVIGN
VICLSWISGSLRTQQTRSGKNSKPYRSWGTEVGPF
Download sequence
Identical sequences ENSOPRP00000001576 ENSOPRP00000001576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]