SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001692 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001692
Domain Number 1 Region: 790-1082
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.98e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000191
Further Details:      
 
Domain Number 2 Region: 31-284
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.95e-60
Family Carbonic anhydrase 0.0000245
Further Details:      
 
Domain Number 3 Region: 1086-1219,1266-1313
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.95e-42
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00026
Further Details:      
 
Domain Number 4 Region: 311-405
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000377
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001692   Gene: ENSOPRG00000001803   Transcript: ENSOPRT00000001836
Sequence length 1407
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5463:375990:845571:1 gene:ENSOPRG00000001803 transcript:ENSOPRT00000001836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTEGYVGTLHENRQGSSVQIRRRKASGDPYWAYSGKWGVVQKVTSSVSCRGHHQSPIDIS
DQHARVGEEYQELQLDGFDNESSNKTWMKNTGKTVAILLKDDYFVSGAGLPGRFKAEKVE
FHWGHSNGSAGSEHSINGRRFPVEMQIFFYNPDDFDAFQTAISENRIIGAMAIFFQVSPR
DNSALDPIIHGLKGVVHHKETFLDPFVLDLHSLGSYRYTGLTTPPCSEIVEWIVFRKPVP
ISHQLEAFYSIFTTEQQDHVKSVEYLRNNFRPQQALNDRVVSKSAVRDAWNHDMADFLDN
PLGTEASKVCSSPPVHMKVQPLNQTALQVSWSQPETVYHPPIMNYVISYSWTKNEDEKEK
TFTKDSDKDLKATISHVSPDSLYLFRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVK
TGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWPEMP
FRKPVSRGDRFSEDSRFITVNPAEKNSSGMISRPSPGRMEWIIPLIVVSALTFVCLILLI
AVLVYWRGCNKVKSKGFPRRFREVPSWERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIP
IIAIPDDMEAIPVKQFVKHVGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPDNKHK
NRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWR
MIWEQNTGIIIMITNLVEKGRRKCDQYWPTENSEEYGNVIVTLKSTKVHACYTVRRFSVR
NTKMKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPDMGPVL
VHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALL
EILGKETEVSSSQLHSYVNSILIPGVGGKTRLEXXXXLVTQCNAKYVECFSAQKECNKEK
NRNSSVVPSERARVGLAPVPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMI
WDHNAQIIVMLPDNQSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXDDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQYQFVYKAMLSLVSTKENGN
GPMTVDTNGAVLIAEESDPAESMESLV
Download sequence
Identical sequences ENSOPRP00000001692 ENSOPRP00000001692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]