SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001789 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001789
Domain Number 1 Region: 124-500
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.56e-127
Family alpha-mannosidase 0.00000000215
Further Details:      
 
Domain Number 2 Region: 862-1143
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.55e-89
Family alpha-mannosidase, C-terminal domain 0.0000173
Further Details:      
 
Domain Number 3 Region: 503-615
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 4.58e-31
Family alpha-mannosidase, domain 2 0.00019
Further Details:      
 
Domain Number 4 Region: 703-779
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000298
Family alpha-mannosidase, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001789   Gene: ENSOPRG00000001918   Transcript: ENSOPRT00000001939
Sequence length 1144
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5080:366143:536114:1 gene:ENSOPRG00000001918 transcript:ENSOPRT00000001939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRSPQREGSFPQGQLSMLQEKIDHLER
LLAENNEIISNIRDSVINLSESVDDGSKSSQGNFSQGAGPHLLLPQLPLQSHPADCLFAS
QRGRQHPDVQMLDVYSLIPFDNPDGGVWKQGFDITYQNDEWDAEPLQVFVVPHSHNDPGW
LKTFNDYFRDKTQYIFNNMVLKLKEDSGRKFIWSEISYFPSXXXXXXXXXXXXXXXXLLE
NGQLEMVTGGWVMTDEATSHYFAMIDQLIEGNQWLEKHVGVKPRSGWAVDPFGHSPTMAY
LLKRAGFSHMLVQRIHYVVKRHFSRQKTLEFFWRQNWDLGSDTDIFCHMMPFYSYDIPHT
CGPDPKICCQFDFNRLPGGRYACPWGVAPEPITLANVQSRAWMLLDQYRKKSKLYRTKVL
LVPLGDDFRFSEYTEWDAQFKNYEQLFKFMNSQPKFKAMIQFGTVSDYFDALDKAAAAES
NNGQSVFPVVSGDFFTYADRDDHYWSGYFTSRPFYKWLDRVMESQLRAAEILYYLALKQA
QKYEIKKFLSSSHYSALTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFHSLMILEKVI
GSSVFLLILKDKHMYDSYSPDSFLEMDLKQKSQDSLPRKNIIEESSEPXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISFIAHMPALGLKVYK
ILESEGSSPRLAEYTLYNGAAKDNGIFKMKNVIDAEEAITIENSFLTLWFDQSGLMKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXIEGQSVEVSNIVDIRNTFNREIAMRISSEINSQDKFYTDLNGY
QIQPRTTMSKLPIQANVYPMTTMAYIQDTRHRLTLLSAQSLGVSSLSSGQIEVIMDRRLM
QDDNRGLGQGVRDNKITANLFRILLEKRSDVNLEEEKNPVSYPSLVSHLTSLFLNHPVFP
MTEKVSASSKLLGEFTPLASPLPCDIHLVNLRTIQAKVGNGYSDEAALILHRKGFDCRFP
SRNTGLFCSTTQGKISVHKLFTKFTVESLTASSLSLMHSPTDAQNISEINLSPMEISTFR
IRLR
Download sequence
Identical sequences ENSOPRP00000001789 ENSOPRP00000001789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]