SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002012 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002012
Domain Number 1 Region: 44-205
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-36
Family Dual specificity phosphatase-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002012   Gene: ENSOPRG00000002194   Transcript: ENSOPRT00000002181
Sequence length 210
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4108:291283:295714:-1 gene:ENSOPRG00000002194 transcript:ENSOPRT00000002181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPGNWLWASMTFMARFSRGSTRSPVRPRGSLEEMPAIQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQDMANNRRELRRLGITHILNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPADMSVXXXXXXXXXXXXXXXXXXRILVHCAVGVSRSATLVLAYLMLYHRLTLVEAIKK
VKDHRGITPNRGFLRQLLALDRRLRQGLEA
Download sequence
Identical sequences ENSOPRP00000002012 ENSOPRP00000002012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]