SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002034 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002034
Domain Number 1 Region: 3-41
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000235
Family LEM domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002034   Gene: ENSOPRG00000002197   Transcript: ENSOPRT00000002203
Sequence length 496
Comment pep:known_by_projection scaffold:pika:scaffold_1989:43744:57092:-1 gene:ENSOPRG00000002197 transcript:ENSOPRT00000002203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEQRLREEARPRGEL
RLREEARLREEAPLRARPTAAPPRAEPWLSPPASAHPKPGAYGDLGASAASWAGSRGLAY
PARPAPLRRRASVRGSSEEDEDARTPDKAALGQGLSGRRWWAASPSPARPSSSLLSPDPR
PGLRAARAGLAGAARARPEVGRWLERCLSRLQLTSGLLLVFVCILVMAKPSAPQEADNMK
LLPVDCEKKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPEKLKSKCIPVVDAQE
YLANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDPSELVTTVDKVVCLESARPRMGVGC
RLSRALLTAVTNVLIFFWCLAFLWGLLILLKYRWRKLEEEEQAMYEMVKKIIDVVQDHYV
DWEQDMERYPYVGILHVRDTLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDM
LVWRWTKPSSFSDSER
Download sequence
Identical sequences ENSOPRP00000002034 ENSOPRP00000002034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]