SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002072 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002072
Domain Number 1 Region: 128-311
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.04e-49
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000579
Further Details:      
 
Domain Number 2 Region: 9-127
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 7.38e-35
Family DNA repair glycosylase, N-terminal domain 0.000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002072   Gene: ENSOPRG00000002246   Transcript: ENSOPRT00000002243
Sequence length 376
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2115:305378:318228:1 gene:ENSOPRG00000002246 transcript:ENSOPRT00000002243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLQGGMRHRTLASDPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGVLADRVW
TLTQTEEHLHCTAYGGAGKPTPRELEAVHQYFQLDVSLAQLYSHWGSVDSHFQEVAQRYP
GVRLLRQDPVECLFSFICSSNNNITRITGMVERLCQAFGPRLAQLDDVTYYGFPSLQALA
GPQVEARLRKLGLGYRARYVSASAQAILEGQGGLAWLQQLRAASYEEAHKALCALPGVGT
KVADCICLMALDKPQAVPVDVHVWQIARRDYGWQPTTSQAKSPSPQANKELGNFFRSLWG
PYAGWAQAGLLGDALDGHQLLCPFVFCQDDLREGSPAGKGDWLGEELSHPPTGDQTQEED
EPPVSPGYRGGRIQPW
Download sequence
Identical sequences ENSOPRP00000002072 ENSOPRP00000002072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]