SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002291 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002291
Domain Number 1 Region: 654-739
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.27e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002291   Gene: ENSOPRG00000002458   Transcript: ENSOPRT00000002481
Sequence length 819
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_56:159843:174371:-1 gene:ENSOPRG00000002458 transcript:ENSOPRT00000002481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGLAAGLQVPRAVPSPDSDSDTDSEGPNTRRAGALLHAQVIHSEHFMVSSPHSDSLT
RRRDQEGPVGHSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLN
NAIWRAWYIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEEEPGGRQLL
GLDCFLSDISDTLFTMTQPRPSPLQLPPEEAYVGNADMIQPDLTPLQPSLDDFMEISDLF
TNYRPPHTPAPPTFPEPPNFIPMADSLFSSGILTSDVPSASASASMGLTHLPGHSRLQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLQEEPVFSPRFPFPTLLQAPPASGLSSLPTPTPFPPTSQQVQAPPPSPFPLDTFL
VYIETALGAHFCVPKARPRTAPPRGQRVSPPSLAPATAGPTVTATARSNNPCLTQLLTAA
AKPEHALEPPLAPSALLRPPESPQEPAPEFPCTFFSPVLTPAPPRPTPGPPSLAPPRPLL
VPKVERLSPPAPSGTERRLSGELHQAPCPVALTVRVSPAPPILSRGRPDNKVTENRRITH
ISAEQKRRFNIKLGFDTLHGLVSTLSAQPSIKVSKATTLQKTAEYIAVLQQERAAMQEEA
QQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDMFEDYVRTRTLHNWKFWVFSIL
IRPLFESFNGMVSTASLHSLRQTSLAWLDQYCSLPALRP
Download sequence
Identical sequences ENSOPRP00000002291 ENSOPRP00000002291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]