SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002349 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002349
Domain Number 1 Region: 554-632,849-1051
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.62e-62
Family Protein kinases, catalytic subunit 0.00047
Further Details:      
 
Domain Number 2 Region: 69-233,271-320
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000089
Family Quinoprotein alcohol dehydrogenase-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002349   Gene: ENSOPRG00000002521   Transcript: ENSOPRT00000002544
Sequence length 1082
Comment pep:known_by_projection scaffold:pika:scaffold_2763:12569:82851:-1 gene:ENSOPRG00000002521 transcript:ENSOPRT00000002544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEHAVPPGSLVALLVPLMLDLTVEPSTGQKRGNPLSMGDVREAVTQVAAAEAGDVAEGTR
VAVQAIRAAARSLVIISTLDGRIAALDPENHGKKQWDLDVGSGALVSSSLSKPEVFGNKV
IIPSLDGDLFQWDRDRESMETVPFTVESLLESSYKFGKNVVLVGGKSLTTYGLGAYSKVR
YICSALGCRRWDGEDMEEEDILLLQRTQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMET
RAGFIESTFKPSENKEESNIISDVEEQEAGTMDTVIKVSVADWKVMAFSKKGGHLEWEYQ
FCTPIASAWLVKDGKVIPISLFDDTSYTPNQEVLEEEEDIVEAARGATESSVYLGMYRGQ
LYMQSSVRISEKFPTSPKALESVNNDNAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCL
SNDKFSHEEYSNGALSILQYPYXXXXXXXXXXXXXXXXXXXXXXXXXXNPSYSKNIRRKD
PVLLLHWWKEILGTILFCIIATTFIVRRLFHPHPHRQRKESETQCQTENKYDAVSGEASD
SSWNDLKISGYVSRYLTDFEPIQCLGRGGFGVVFEARNKVDDCNYAIKRIRLPNRELARE
KVMREVKALAKLEHPGIVRYFNAWLEAPPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPS
VKIRRVGPFSAKEHIEIIAPSLQRSRSFSVGISCGQTSSSESQFSPLEFSGTEQGDISES
GGVASNLLDSCLTDCDVEDGTMDGNDEGHPFELCPSEASPYSRFRERTSSSIVFEDSGCD
NASSKEEPGARRLRLGSHCANKLASCDTSSSSSASEPTLSVSPSRPTTLSLDLTKNTTEK
LQPSSPKVYLYIQMQLCRKENLKDWMSRRCTLEERERSTCLHIFLQITEAVDFLHSKGLM
HRDLKPSNIFFAMDDVVKVGDFGLVTAMDQDEEEQAVLTPMPAYATHTGQVGTKLYMSPE
QNHGNNYSHKVDIFSLGLILFELLYPFSTQMERVRTLTDVRNLKFPSLFTQKYPQEYVMV
QGMLSPSPTDRPEAANIIENALFEELELPGKTVLRQRSRSASSSGTKHSRQPSSSQSPLP
ST
Download sequence
Identical sequences ENSOPRP00000002349 ENSOPRP00000002349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]