SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002429 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002429
Domain Number 1 Region: 122-287
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.45e-50
Family CRAL/TRIO domain 0.0000285
Further Details:      
 
Domain Number 2 Region: 24-102
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.58e-18
Family CRAL/TRIO N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002429   Gene: ENSOPRG00000002645   Transcript: ENSOPRT00000002629
Sequence length 354
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4294:84176:232543:1 gene:ENSOPRG00000002645 transcript:ENSOPRT00000002629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVSLLPKYQRVSPWEGDLATMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMI
ITRPDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKR
ALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGF
ILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFL
KDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDMGTWARTLLGPDYSDENDYTH
TSYNAMHVKHTYSNLERECSPKPMKRSQSVVEAGTLKHEEKGENENTQPLLALD
Download sequence
Identical sequences ENSOPRP00000002429 ENSOPRP00000002429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]