SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002476 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002476
Domain Number 1 Region: 465-625
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.28e-59
Family Hemopexin-like domain 0.0000000188
Further Details:      
 
Domain Number 2 Region: 89-218,391-446
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.22e-37
Family Matrix metalloproteases, catalytic domain 0.000000374
Further Details:      
 
Domain Number 3 Region: 278-334
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-21
Family Fibronectin type II module 0.0000617
Further Details:      
 
Domain Number 4 Region: 337-393
Classification Level Classification E-value
Superfamily Kringle-like 1.08e-20
Family Fibronectin type II module 0.0000833
Further Details:      
 
Domain Number 5 Region: 42-107
Classification Level Classification E-value
Superfamily PGBD-like 1.57e-19
Family MMP N-terminal domain 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002476   Gene: ENSOPRG00000002679   Transcript: ENSOPRT00000002685
Sequence length 628
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3300:153828:174116:1 gene:ENSOPRG00000002679 transcript:ENSOPRT00000002685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPVARGALAGLLRALCVLGCLLGRAVAPPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGELDQNTIETMRKPRCGNPDVANYNFFPRKPKWE
KNQITYRIIGYTPDLDPETVDDAFARAFQVWSAVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFTMGGNADGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTIGGNSEGAPCVFPFTFLGTKY
ESCTSAGRSDSKMWCATSANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTFTKNFRLSQDDIKGIQELYGPSPDADVDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
QYWVYSASTLERGYPKPLTSLGLPPDIQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKM
DPGFPRLIADAWNAIPDNLDAVVDLQGG
Download sequence
Identical sequences ENSOPRP00000002476 ENSOPRP00000002476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]