SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002482 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002482
Domain Number 1 Region: 352-607
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.71e-80
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 197-305
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-34
Family Kringle modules 0.00044
Further Details:      
 
Domain Number 3 Region: 37-91
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-18
Family Fibronectin type II module 0.0051
Further Details:      
 
Domain Number 4 Region: 98-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002482   Gene: ENSOPRG00000002694   Transcript: ENSOPRT00000002694
Sequence length 609
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3894:73965:81632:-1 gene:ENSOPRG00000002694 transcript:ENSOPRT00000002694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWALLLLGSLLAGLESALAIPPWKAPKEHKHRADPHMVVLTVTGEPCHFPFQYRRQLYY
TCIHHARPGPRPWCATTPNFDQDQQWAYCQERQKVQDHCGKHSPCHRGATCVNTPRGPHC
FCPQHLTGKHCEREKCFEPQLLRTFHENDIWHRFEAGGVARCRCKGPDAHCKLLASQVCP
TNPCLNQGRCLMAEGHRLCQCPPPYKGPFCDLDTEASCYQGRGLNYRGMAKTTVSGASCQ
SWDSEATYRNMTAEQALRLGLGHHAFCRNPDNDLRPWCFVLSGDRLSWEYCSLEPCQTPA
QTAPPVRVLPERQDSPLPRPSAQQKPQPTTLTPLPPPAETSGTLTWGQTPPFQCGQRLRK
QLSRIVGGLVALPGAHPYMAALYWGHSFCAGSLIAPCWVLTAAHCLQNRPAPEELTVVLG
QELHNQSCARCQTLTVRSYHLHEDFSPISYQHDLALLRLQESATGSCALLSTYVQPVCLP
SGIAQTAESEGVLCEVAGWGHQYEGAEEYSSFLQEAQVPLVSSERCSAPDVHGAAILPGM
LCAGFLEGGTDACQGDSGGPLVCEEGDEKPKLTLRGIISWGSGCGDRYKPGVYTDVANYL
AWIREHTAT
Download sequence
Identical sequences ENSOPRP00000002482 ENSOPRP00000002482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]