SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002800 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002800
Domain Number 1 Region: 46-235
Classification Level Classification E-value
Superfamily CutC-like 5.75e-64
Family CutC-like 0.00000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002800   Gene: ENSOPRG00000003045   Transcript: ENSOPRT00000003039
Sequence length 235
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2378:45258:103123:1 gene:ENSOPRG00000003045 transcript:ENSOPRT00000003039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQGLSGERKPARLSSGKAXXXXXXXXXXXXXXXXXXXXXXXXXAGRIELCSGLLEGGI
TPSMGLLQIVKQSVQIPVFVMIRPRGGDFLYSDREVEVMKADIQLAKLYGADGLVFGALT
EDGQINKELCMCLIALCRPLPVTFHRAFDMVHDPMEALQTLLTLGFERVLTSGCDSSALE
GLPLIKRLTDEAKGRIVVMPGGGITERNLQRILEGSGATEFHCSARSARDSGMKF
Download sequence
Identical sequences ENSOPRP00000002800 ENSOPRP00000002800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]