SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002833 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002833
Domain Number 1 Region: 231-294
Classification Level Classification E-value
Superfamily RILP dimerisation region 9.29e-16
Family RILP dimerisation region 0.0000615
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000002833
Domain Number - Region: 80-125
Classification Level Classification E-value
Superfamily BLRF2-like 0.00955
Family BLRF2-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002833   Gene: ENSOPRG00000003064   Transcript: ENSOPRT00000003075
Sequence length 381
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2033:126576:129943:-1 gene:ENSOPRG00000003064 transcript:ENSOPRT00000003075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRKMVPGAQGWGPRVPTGSGTAAELVYHLAGALGTELQELARRFGPEAAAGLVPLVVR
ALELLEKTVVGPTPDSLQVSAQQAELELRQLREENKHLRRELRSRPQEEHALLRQLKEVT
DRQRDELRAHGRDLQQRSLETEALQEQLQRLLLVNAELRHKLAAVQTQLRTARDRERERE
VQTKTPQAAEQGHTDGEPVWAAAGASTPPDSPAAAPRQVGHPSEAEQCGFSRQELEQILH
ERIEFKAKVFLLEDELAYFQRELLADHRVPGLLLDAMKVAVRKQRKKIKAKMLGTPEEAE
SSDDEDGSWLLISSDKEDRPPSPESRIQSFFSPWYRGEAETPKPETSSPTASLWSLGGAP
QLPAPDQPHLRWQTSAVLQAW
Download sequence
Identical sequences ENSOPRP00000002833 ENSOPRP00000002833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]