SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002958 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002958
Domain Number 1 Region: 309-390
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.28e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002958   Gene: ENSOPRG00000003229   Transcript: ENSOPRT00000003220
Sequence length 392
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_163:132967:137683:-1 gene:ENSOPRG00000003229 transcript:ENSOPRT00000003220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVCAGCRAAPSRRGAAPLQVAGGGSVGADMYFDSYQHYFYDYDCGENFHRSAPSENIWK
QFELVPSPPTSPPLGSGPAAGDPVSGIAPPESWPGCVGNEAKSRAHWKAWGRNYASIIRR
DCMWSGFSARERLERVVSDRLAPGAPRSNPPKAPAAPDCTPTLEAANPPPAAPCQLGEPK
TQACSGSESPSDSEGEEIDVVTVEKRQSLGLRKPVTITVRADPLDPCMKRFHISIHQQQH
NYAARFPPESHSQEGAPEGAPPGEALQREAAEEKEEEEDAEMVSLPPAENQASQPCHPRP
VSSDTEDLTKRKNHNFLERKRRNDLRSRFLALRDQVPTLASCSKAPKVVILSKALEYLQA
LVGAEKRMATEKRQLRCRQQQLQKRIAYLSGY
Download sequence
Identical sequences ENSOPRP00000002958 ENSOPRP00000002958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]