SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002979 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002979
Domain Number 1 Region: 362-769
Classification Level Classification E-value
Superfamily ALDH-like 6.41e-90
Family ALDH-like 0.000000113
Further Details:      
 
Domain Number 2 Region: 101-228
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.00000000000000111
Family PyrH-like 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000002979
Domain Number - Region: 271-352
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.000929
Family N-acetyl-l-glutamate kinase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002979   Gene: ENSOPRG00000003232   Transcript: ENSOPRT00000003246
Sequence length 794
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_1079:364577:407353:-1 gene:ENSOPRG00000003232 transcript:ENSOPRT00000003246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQVYRSGFKPFNQHLLPWVQSTAVSRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLFDSPPSDDAKLIDIFYPGDQQXXXXXXXX
XXXXXXXXXXVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGP
TVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAP
LLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRVAKNLELEQVTVPIGVLLVIFE
SRPDCLPQVAALAIASGNGLLLKGGKEATHSNRILHLLTQEALSIHGVKEAVQLVNTREE
VEDLCRLDKIIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYMDSEASVDKVTRLV
RDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEV
KSLRTEYGDLELCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVFW
NASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGTLK
YLHENLPVPQRNTN
Download sequence
Identical sequences ENSOPRP00000002979 ENSOPRP00000002979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]