SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002983 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002983
Domain Number 1 Region: 83-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002983   Gene: ENSOPRG00000003267   Transcript: ENSOPRT00000003250
Sequence length 272
Comment pep:known_by_projection scaffold:pika:scaffold_72:344412:345230:-1 gene:ENSOPRG00000003267 transcript:ENSOPRT00000003250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDLVQKMPGESLARAG
AKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVRK
LSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHTANAVHP
VHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCP
CTICQMPPPPHLSALSTANMARLSAESKDLLK
Download sequence
Identical sequences XP_004587323.1.84141 ENSOPRP00000002983 ENSOPRP00000002983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]