SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003067 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000003067
Domain Number - Region: 106-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00016
Family VPS37 C-terminal domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003067   Gene: ENSOPRG00000003361   Transcript: ENSOPRT00000003342
Sequence length 283
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2479:4092:15919:-1 gene:ENSOPRG00000003361 transcript:ENSOPRT00000003342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAASEARFAGLSLVQLHELLEDEAQLTDMVQKMEEAQTVQLSKEMTLASNRSLAEGNL
LYQPQLDSRKACLTQKYQELQALFETYQIKKTKLDQQSSSASLETLLALLQAEGAKIEED
TENMAEQFLDGELPLDSFVDAYQSKRKLAHTRRVKIEKLQEMVLKGQRLPPAPLPPRTSE
PAPVASLPYPSTEASGGPSAVPRRVPPPPPPVPAGRLATPFAAASGLGQANPYPGFQCPP
LPPRESLPAQPGFSAQFVSPYPPALPQRPPPRLPPHQPGFILQ
Download sequence
Identical sequences ENSOPRP00000003067 ENSOPRP00000003067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]