SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003335 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003335
Domain Number 1 Region: 445-584,701-718
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 6.93e-48
Family Substrate-binding domain of HMG-CoA reductase 0.00000015
Further Details:      
 
Domain Number 2 Region: 587-703
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.96e-45
Family NAD-binding domain of HMG-CoA reductase 0.00000051
Further Details:      
 
Domain Number 3 Region: 45-219
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0000262
Family Multidrug efflux transporter AcrB transmembrane domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003335   Gene: ENSOPRG00000003618   Transcript: ENSOPRT00000003628
Sequence length 719
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4838:799:12590:1 gene:ENSOPRG00000003618 transcript:ENSOPRT00000003628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLFRMHGLLVASHPWEVIVGTVTLTICMMSMNMFTGNDKICGWNYECPKFEEDVLSS
DIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTG
LNEALPFFLLLIDLSRASALAKFALSSNSQDEVRENIARGMALLGPTFTLDALVECLVIG
VGTMSGVRQLEIMCCFGCMSVLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFAR
VLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADSAKVSLGLDENVSKR
IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQAETESTLSLKNPITSPVVA
QKKVPDSCCRREPVLVRNHQKSYAVEEEAGGNQERKAEVIKPLVAEADPSHRAVFVVGGS
SLPDTTLVLETQEVEIELPREPRPNEECLQILGNAEKGAKFLSDAEVIQLVNAKHIPAYK
LETLMETHERGVSIRRQLLSKKLPEPSSLQHLPYRDYNYSLVMGACCENVIGYMPIPVGV
VGPLCLDGKEFQVPMATTEGCLVASTNRGCRAICLGGGASSRVLADGMTRGPVVRLPRAC
DSAEVKAWLETPEGFAVIKEAFDSTSRFARLQKLHTSMAGRNLYIRFQSRTGDAMGMNMI
SKGTEKALSKLQEYFPEMQILAVSGNYCTDKKPAAVNWIEGRGKTVVCEAVIPAKVVRE
Download sequence
Identical sequences ENSOPRP00000003335 ENSOPRP00000003335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]