SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003406 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003406
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily FKBP-like 3.14e-36
Family FKBP immunophilin/proline isomerase 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003406   Gene: ENSOPRG00000003723   Transcript: ENSOPRT00000003705
Sequence length 95
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4179:79830:84731:1 gene:ENSOPRG00000003723 transcript:ENSOPRT00000003705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLGQRA
KLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Download sequence
Identical sequences A0A2I3MYB5 A0A2K5ZAR5 G3QH78
ENSSARP00000012480 ENSEEUP00000012676 ENSOPRP00000003406 ENSEEUP00000012676 ENSPCAP00000012876 ENSSARP00000012480 ENSOPRP00000003406 ENSPCAP00000012876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]