SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003415 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000003415
Domain Number - Region: 15-111
Classification Level Classification E-value
Superfamily DNA clamp 0.000879
Family DNA polymerase processivity factor 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003415   Gene: ENSOPRG00000003734   Transcript: ENSOPRT00000003714
Sequence length 279
Comment pep:known_by_projection scaffold:pika:scaffold_29377:7719:8558:-1 gene:ENSOPRG00000003734 transcript:ENSOPRT00000003714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRARITRRAFLELFIHLCSTLAKLAKLVVLRVCPDGLYFGSAGLRAVPEASVWCEVRR
EAFSQFRMEGPSEEHDEIYLELTSGHLARALRSAGGASSVKLQLTHKRRPCLTVAAELAL
RTGHTRMVVHDLPVRVLPRRAWAECPQRPRLPSPDVSVHLPPLRTLRSIVERMANLSQHV
LLEASPQGRMHLSIDTSAVSIRSSFENLGRPPRAQQDGAEDRDPKSMAQVRVDNRRLLHF
LEAQQMNPTTALCNIRSDALLHLVLLNNDVSLEYLIPTV
Download sequence
Identical sequences ENSOPRP00000003415 ENSOPRP00000003415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]