SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003458 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003458
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000981
Family VPS37 C-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003458   Gene: ENSOPRG00000003777   Transcript: ENSOPRT00000003761
Sequence length 362
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5521:132382:138331:-1 gene:ENSOPRG00000003777 transcript:ENSOPRT00000003761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEEMQNDPEVISRLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPSTLLDLLQIEGMKTEEESEAMAE
KFLEGEVPLETFLENFASMRMLSHLRRVRVEKLQDVVRKPRASQEPSGSVPPPRPPPPPR
PAPQVTPPVAEEQPLPSVPSGLPVVPPYPLPYSPSPSLPVGPTAQGALQPAPFPVVSQPS
FSYGPPLGPSYPSAQPAPRAAAAGYSWSPQRSIPPRPGYPVAPVGASGPGYPLAGGPTPS
PGYPQQSPYRPGGGKPPYPTQPQLPGFPGQPQPSVPPRPPYPPGPAPPYGFPPPPGPAWP
GY
Download sequence
Identical sequences ENSOPRP00000003458 ENSOPRP00000003458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]