SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003693 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003693
Domain Number 1 Region: 100-237
Classification Level Classification E-value
Superfamily dUTPase-like 3.79e-49
Family dUTPase-like 0.000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003693   Gene: ENSOPRG00000004021   Transcript: ENSOPRT00000004010
Sequence length 238
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_2374:966341:994605:1 gene:ENSOPRG00000004021 transcript:ENSOPRT00000004010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALVSRTALRYHFLPSWLGSRFSDAWLGCGTEGLSRPGPPVGPTAQPRLLSSSTRRSRG
CSRAGKAGGDRKDSGDAEGPIPAVSPSKRARPAEEGMLRLRFTRLSEHATAPTRGSARAA
GYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYR
GNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVEALDDTERGSGGFGSTGKN
Download sequence
Identical sequences ENSOPRP00000003693 ENSOPRP00000003693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]