SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003706 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003706
Domain Number 1 Region: 89-310
Classification Level Classification E-value
Superfamily DNA-glycosylase 5.65e-68
Family Mismatch glycosylase 0.0000268
Further Details:      
 
Domain Number 2 Region: 355-494
Classification Level Classification E-value
Superfamily Nudix 1.16e-29
Family MutY C-terminal domain-like 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003706   Gene: ENSOPRG00000004007   Transcript: ENSOPRT00000004025
Sequence length 544
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_5452:74663:82248:-1 gene:ENSOPRG00000004007 transcript:ENSOPRT00000004025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRFPRPSCRSVIMRKPQGAVGGGHRKQAACKKRREQHSLTSSQTKPAPDGRISECPEA
PAGPAGQHEEAMSQISISPYHRFKDPAEVLAFRGNLLTWYDREKRDLPWRRLAEAEVDLD
RRAYAVWVSEVMLQQTQVATVISYYTRWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGR
RLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVVRVLC
RVRAIGADPSSTPVSQQLWSFAQQLVDPVRPGDFNQAAMELGATVCTPQRPLCNRCPVQH
LCQAHQRVEQEQLCASPRLPSSPEIEECALNTGQCQLCPPPSEPWDPTLGVTNFPRKASR
KPPREECSATCVVEQPKARGGGRMLLVQRPHSGLLAGLWEFPSVTLEPSGQHPRQALLQE
LQSWAGPLPAACLRHLGEVVHTFSHIKLTYQVYGLTLDSDTLATTTPPGARWLTREEFCT
AAVSTAMKKVFRVYEGQKPGTRQGSKRSLVATPLRQKRPSKGQQVLDGFLRITSDGPHLN
NAAP
Download sequence
Identical sequences ENSOPRP00000003706 ENSOPRP00000003706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]