SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003736 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000003736
Domain Number - Region: 83-183
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0879
Family YicI N-terminal domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003736   Gene: ENSOPRG00000004076   Transcript: ENSOPRT00000004057
Sequence length 307
Comment pep:novel genescaffold:pika:GeneScaffold_1137:200869:208598:-1 gene:ENSOPRG00000004076 transcript:ENSOPRT00000004057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSSNGPVKKSMREKAVERRNVNKEHNSNFKAGYIPIDEDRLHKTGLRGRKGNLAICVIIL
LFILAVINLIITLVIWAVIRIGPNGCDSLEFHESGLLRFKQVSDMGVIHPLYRSTVGGRR
NENLVITGNNQPIVFQQGTTKLSVEKNKTSITSDIGMQFVDPRTQNVLFSTDYETHEFHL
PSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRANEGVFIMGKTIEFXXXXXXXXXX
ENSIILNGTVMVSTTRLPSASGTDQLGSSDWVRYKLCMCADGTLFKVQVTSQNMGCQTAD
NPCGSTY
Download sequence
Identical sequences ENSOPRP00000003736 ENSOPRP00000003736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]