SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003843 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003843
Domain Number 1 Region: 13-245
Classification Level Classification E-value
Superfamily UROD/MetE-like 1.01e-71
Family Uroporphyrinogen decarboxylase, UROD 0.00000000151
Further Details:      
 
Domain Number 2 Region: 290-361
Classification Level Classification E-value
Superfamily UROD/MetE-like 2.62e-19
Family Uroporphyrinogen decarboxylase, UROD 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003843   Gene: ENSOPRG00000004153   Transcript: ENSOPRT00000004172
Sequence length 365
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_4323:423050:429199:1 gene:ENSOPRG00000004153 transcript:ENSOPRT00000004172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESNGSGPQGFPELENDSFLRAAWGDETDFTPVLCMRQGGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPKGPSFPEPLREEQDLERL
RDPATVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGSSSTMSQAKRWL
YQRPQASHRLLRLLTDALVPYLVGQVAAGAQALQLFESHAGHLGPQLFNEALPYIRDVSK
RVKAGLQEAGLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERVGKMVTLQ
GNLDPCALYASKEEIGQLVRQMLDGFGPQRYIANLGHGLYPDMDPEHVGAFVDAVHRHSR
LLRQN
Download sequence
Identical sequences ENSOPRP00000003843 ENSOPRP00000003843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]