SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003853 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003853
Domain Number 1 Region: 403-577,609-704
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.7e-53
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00065
Further Details:      
 
Domain Number 2 Region: 704-747
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000112
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0006
Further Details:      
 
Domain Number 3 Region: 1141-1176
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 0.0000000000201
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003853   Gene: ENSOPRG00000004181   Transcript: ENSOPRT00000004182
Sequence length 1176
Comment pep:novel genescaffold:pika:GeneScaffold_5158:37339:116198:1 gene:ENSOPRG00000004181 transcript:ENSOPRT00000004182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSMNPGNWVTFDDDLAFQASQRPKSLPLGTQGVSRPNGLKLNLSGPKEFPSGSSSTGST
PLSSPIVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPEASSNSPLTTDSSF
LSPKPTCSSHALLSSDHTDASPAPKAGLPSEISTHETESQRFQGDAPQFQYFREDCAFSS
PFWKDESGASQFTLEALGSRKTFSLRDKETPVYQKSLNKCSLSYICEKLEHLQSAENRES
SLGSVSTRCLDTEGPASAFVPHTLFRSQPTSGWSFMLRIPEKKNMMSSRQWGPIFLKVLP
GGILQMYYEKGLERPFRELQLDPHCRLSEPKVESFSVAGKIHTVKIEHVSYTEKRKYHSK
AEVVHEADIEQMLKLGTTEYHDFLDFLTTVEEELVTLPAVAKPRRSYEEQEMTVEVVDHF
WGRVTREEGKLVESAVITQISCLCFVNGNAECFLTLNDLELQKLDESYFEKDTERRGINI
LDYHFHKCVKVQEFEQSRIIKFAPLDACRFELMRFKTLYDGSDLPFSVKSVVVVQGAYVE
LQAFINMAPLAQRPSLASPLQSCDSVTIHFPVPSQWIKLWTMNLQRQKSLKAKMNLRACL
GSLHELESEPVIQVTVGSAKYENAFRAAVWKIRLPDKXXXPDHPHCLSCKLELGSDQEIP
SDWYSFATVQFVMLDTCASGTVVRSLGVESDVQPQKHVHQRACYNIQPKLYRSVIEDVIE
AVRNLFAEEGVEEQVLKDLKQLWETKILQSKATEDFFRHSVRPPVFTFQLPHGLHQAVQS
PTASIIIPTGRTLPSFTTELGTSTPSTNLTFAGYPVHVPAGVTLQSASGHLYKVSVPIMV
TQTSGRANILQHPFQQVFQQFGQPSLIPASVPRLGLCSLQATTEKSQRVETMLQQPTIPC
SGPRSRRRLENGTSDTAVPGNEYKILSDALLSQQASSQFVCLEGGAFPLQVXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXESVSQVNFNIQAADEDTNEIIQIDGTDDTSSNEELEGTRDVEESEFPGIIDVGDLK
VLEEEADSISNEDSTANSSENEDSQIAIVEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XIHRSKNKWKLCLKDGVMCFGRRDYVFAKAIGDAEW
Download sequence
Identical sequences ENSOPRP00000003853 ENSOPRP00000003853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]