SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003874 from Ochotona princeps 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003874
Domain Number 1 Region: 29-133
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000301
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 2 Region: 171-223
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000707
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003874   Gene: ENSOPRG00000004203   Transcript: ENSOPRT00000004204
Sequence length 609
Comment pep:known_by_projection genescaffold:pika:GeneScaffold_3296:97943:131834:1 gene:ENSOPRG00000004203 transcript:ENSOPRT00000004204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGDAWGQPSRAGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVEL
TGNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSG
YKVIHCSGYLKIRQYMLDMTLYDSCYQIVGLVAVGQSLPPSAITEIKLHSNMFMFRASLD
LKLIFLDSRVTELTGYEPQDLIEKTLYHHVHGCDAFHLRYAHHLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQYSPFQMDKLECSPLGSWRVSPPAGTAAAP
DQQLHSESNELLYAPSYSLPFSYRYGPFPLDSHVFSGKQPMLPAKFGXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPAAVTARRFAEDT
APPSFPSCGHYREEPGLGPAKVARQAAVARDGARGCVPECCAPMAPEPPGAPAQLPLVLL
NYHRVLARRGPLGNAADPVPGPAGGPDTEAGAAGTASGLRPRLPSPAGPPPGAPRPHYLG
ASVIITNGR
Download sequence
Identical sequences ENSOPRP00000003874 ENSOPRP00000003874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]